Because SARS-CoV-2 has been found in Quebec white tailed deer
Positions 340-370
KSVPSPLNWERKTFSNCNFNMSSLMSFIQAD
we post the sequence of white-tailed Ohio deer for comparison.But these military virologists leave out the tryptophan (W) that links bat and pig to Ralph Baric’s lab manipulation of the Kunming virus, RsSHC014. We will un-capitalize positions 352 and 354, because those are two of the 35B5 antibody locations (A352, N354). Putting this to graph paper improves the alignments:
SARS-CoV-2/RaTG13 (closest relative bat virus) are idential in these positions.
EVFNATTFASVYaWnRKRISNCVADYSVLYNSTFS
PHEV, Canada (1962) The sequence is shifted so that amino relationships can be seen.
KIVSSPLNWERKiFsNCNFNMGRLMSFIQAD
Daszak-Shi-Baric Kunming bat virus, RaTG13
PSVYAWERKRISNCVAdYsVLYNSTSFSTF
(This virus has W969, whereas Omicron variant has N969)
So, the expression of all four viruses is nearly the same with the phrase, ‘WERKRISNCV’. As already shown, this is the region for both human and pig coronavirus deletions. Baric’s W is between both communist antibodies.
Positions 340-370
KSVPSPLNWERKTFSNCNFNMSSLMSFIQAD